Atlas Antibodies Anti-DEFA6 Antibody

상품 한눈에 보기

Human DEFA6 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 비교 검증 완료. PrEST 항원으로 친화 정제된 고품질 항체입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019462-100 Anti-DEFA6 Antibody, defensin, alpha 6, Paneth cell-specific 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019462-25 Anti-DEFA6 Antibody, defensin, alpha 6, Paneth cell-specific 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

defensin, alpha 6, Paneth cell-specific

IHC (Immunohistochemistry)
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Western Blot)

Polyclonal Antibody against Human DEFA6

DEF6, HD-6

항목	내용
Target Protein	defensin, alpha 6, Paneth cell-specific
Target Gene	DEFA6
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	PLQAEDDPLQAKAYEADAQEQRGANDQDFAVSFAEDASSSLRALGSTRAFTCHCRRSCYSTEYSYGTCTVMGINHRFC
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000061751 (35%), Mouse ENSMUSG00000082211 (35%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand