
Thermo Fisher Scientific ACRBP Polyclonal Antibody
Human ACRBP 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC(P), ICC/IF에 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, PBS/glycerol 버퍼에 보관. 종특이성은 Human이며, 연구용으로 적합.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ACRBP Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.04–0.4 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:5,000–1:10,000 |
| Immunocytochemistry (ICC/IF) | 0.25–2 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human ACRBP. Recombinant protein control fragment (Product #RP-97713) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2637615 |
Product Specific Information
Immunogen sequence:
AKRVLCSQPVSILSPNTLKEIEASAEVSPTTMTSPISPHFTVTERQTFQPWPERLSNNVEELLQSSLSLGGQEQAPEHKQEQGVEHRQEPTQEHKQE
- Highest antigen sequence identity to the following orthologs:
- Mouse: 65%
- Rat: 68%
Target Information
The protein encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and condensation of the acrosin zymogen in the acrosomal matrix.
This protein is a member of the cancer/testis family of antigens and is immunogenic. In normal tissues, its mRNA is expressed only in testis, whereas it is detected in various tumor types such as bladder, breast, lung, liver, and colon.
[provided by RefSeq, Jul 2008]
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
