
Thermo Fisher Scientific ACRBP Polyclonal Antibody
Human ACRBP 단백질을 인식하는 Rabbit Polyclonal 항체로, WB, IHC(P), ICC/IF에 사용 가능. 항원 친화 크로마토그래피로 정제되었으며, PBS/glycerol 버퍼에 보관. 종특이성은 Human이며, 연구용으로 적합.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.04–0.4 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 1:5,000–1:10,000 |
| Immunocytochemistry (ICC/IF) | 0.25–2 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant protein corresponding to Human ACRBP. Recombinant protein control fragment (Product #RP-97713) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.5 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2637615 |
Product Specific Information
Immunogen sequence:
AKRVLCSQPVSILSPNTLKEIEASAEVSPTTMTSPISPHFTVTERQTFQPWPERLSNNVEELLQSSLSLGGQEQAPEHKQEQGVEHRQEPTQEHKQE
- Highest antigen sequence identity to the following orthologs:
- Mouse: 65%
- Rat: 68%
Target Information
The protein encoded by this gene is similar to proacrosin binding protein sp32 precursor found in mouse, guinea pig, and pig. This protein is located in the sperm acrosome and is thought to function as a binding protein to proacrosin for packaging and condensation of the acrosin zymogen in the acrosomal matrix.
This protein is a member of the cancer/testis family of antigens and is immunogenic. In normal tissues, its mRNA is expressed only in testis, whereas it is detected in various tumor types such as bladder, breast, lung, liver, and colon.
[provided by RefSeq, Jul 2008]
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific MUCL1 Polyclonal Antibody
796,700원

Thermo Fisher Scientific
Thermo Fisher Scientific AKAP11 Polyclonal Antibody
796,700원

Thermo Fisher Scientific
Thermo Fisher Scientific ACRBP Polyclonal Antibody
799,600원

Thermo Fisher Scientific
Thermo Fisher Scientific VWA8 Polyclonal Antibody
773,300원

Thermo Fisher Scientific
Thermo Fisher Scientific ACRBP Polyclonal Antibody
796,700원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|