
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SBSN Antibody
상품 한눈에 보기
Atlas Antibodies의 Anti-SBSN Antibody는 인간 SBSN 단백질을 인식하는 폴리클로날 항체로, IHC 및 RNA-seq 비교를 통한 정교한 단백질 발현 검증에 적합합니다. Rabbit IgG 기반, 고순도 친화정제 방식으로 제조되어 높은 특이성과 재현성을 제공합니다.
- 카탈로그번호
- HPA067734-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA067734-100 Anti-SBSN Antibody, suprabasin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA067734-25 Anti-SBSN Antibody, suprabasin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SBSN Antibody
Anti-SBSN Antibody
Target Protein: suprabasin (SBSN)
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against human SBSN.
Alternative Gene Names
HLAR698, UNQ698
Antigen Information
Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:KELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVNNAAGQAGKEADKAVQGFHTGVH
Verified Species Reactivity
Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000046056 | 55% |
| Rat | ENSRNOG00000021015 | 50% |
Antibody Characteristics
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



