CacheBy
Atlas Antibodies Anti-SBSN Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-SBSN Antibody

상품 한눈에 보기

Human SBSN 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증 완료. Recombinant PrEST 항원을 이용해 친화 정제됨. RNA-seq 데이터 기반 발현 비교로 검증된 신뢰성 높은 항체. 다양한 조직에서의 단백질 발현 연구에 적합.

카탈로그번호
HPA062568-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA062568-100 Anti-SBSN Antibody, suprabasin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062568-25 Anti-SBSN Antibody, suprabasin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-SBSN Antibody

Anti-SBSN Antibody

Target Protein: suprabasin (SBSN)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human SBSN.


Alternative Gene Names

HLAR698, UNQ698

Open Datasheet (PDF)


Antigen Information

  • Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
  • Sequence:
    KELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVNNAAGQAGKEADKAVQGFHTGVH

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000046056 55%
Rat ENSRNOG00000021015 50%

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.


Buffer Composition

Component Description
Glycerol 40%
PBS pH 7.2
Sodium azide 0.02%, preservative

Material Safety Data Sheet (MSDS)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.