AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-SBSN Antibody
상품 한눈에 보기
Human SBSN 단백질을 인식하는 토끼 폴리클로날 항체로, IHC Orthogonal 검증 완료. Recombinant PrEST 항원을 이용해 친화 정제됨. RNA-seq 데이터 기반 발현 비교로 검증된 신뢰성 높은 항체. 다양한 조직에서의 단백질 발현 연구에 적합.
- 카탈로그번호
- HPA062568-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA062568-100 Anti-SBSN Antibody, suprabasin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA062568-25 Anti-SBSN Antibody, suprabasin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-SBSN Antibody
Anti-SBSN Antibody
Target Protein: suprabasin (SBSN)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human SBSN.
Alternative Gene Names
HLAR698, UNQ698
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
KELDKGVQGLNHGMDKVAHEINHGIGQAGKEAEKLGHGVNNAAGQAGKEADKAVQGFHTGVH
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000046056 | 55% |
| Rat | ENSRNOG00000021015 | 50% |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
| Component | Description |
|---|---|
| Glycerol | 40% |
| PBS | pH 7.2 |
| Sodium azide | 0.02%, preservative |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.