CacheBy
Atlas Antibodies Anti-RTKN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RTKN2 Antibody

상품 한눈에 보기

Human RTKN2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. 독립 항체 검증을 통해 높은 특이성과 재현성을 확보했으며, Rabbit 유래 IgG 형식으로 정제된 고품질 제품입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038446-100 Anti-RTKN2 Antibody, rhotekin 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038446-25 Anti-RTKN2 Antibody, rhotekin 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RTKN2 Antibody

Anti-RTKN2 Antibody

Target Protein: rhotekin 2
Supplier: Atlas Antibodies

  • IHC (Independent validation)
  • ICC

Validation of protein expression in IHC
Independent antibodies targeting different epitopes of the protein are compared to validate expression.

Product Description

Polyclonal antibody against Human RTKN2

Alternative Gene Names

bA531F24.1, Em:AC024597.2, FLJ39352, PLEKHK1

Open Datasheet (PDF)

Technical Specifications

항목 내용
Target Protein rhotekin 2
Target Gene RTKN2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Antigen Sequence Detail GANVFDTDVVNVDKTITDICFENVTIFNEAGPDFQIKVEVYSCCTEESSITNTPKKLAKKLKTSISKATGKKISSVLQEEDDEMCLLLSSA
Verified Species Reactivity Human
Interspecies Information Mouse (80%), Rat (78%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.