Atlas Antibodies Anti-RTKN2 Antibody
상품 한눈에 보기
Human RTKN2 단백질을 인식하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. 독립 항체 검증을 통해 높은 특이성과 재현성을 확보했으며, Rabbit 유래 IgG 형식으로 정제된 고품질 제품입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RTKN2 Antibody
Target Protein: rhotekin 2
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent validation)
- ICC
Validation of protein expression in IHC
Independent antibodies targeting different epitopes of the protein are compared to validate expression.
Product Description
Polyclonal antibody against Human RTKN2
Alternative Gene Names
bA531F24.1, Em:AC024597.2, FLJ39352, PLEKHK1
Technical Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | rhotekin 2 |
| Target Gene | RTKN2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Antigen Sequence Detail | GANVFDTDVVNVDKTITDICFENVTIFNEAGPDFQIKVEVYSCCTEESSITNTPKKLAKKLKTSISKATGKKISSVLQEEDDEMCLLLSSA |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse (80%), Rat (78%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
- Material Safety Data Sheet (MSDS)
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.