CacheBy
Atlas Antibodies Anti-RTL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RTL1 Antibody

상품 한눈에 보기

휴먼 RTL1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 반응하며, Rat 및 Mouse와 74% 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA066979-100 Anti-RTL1 Antibody, retrotransposon-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066979-25 Anti-RTL1 Antibody, retrotransposon-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RTL1 Antibody

Anti-RTL1 Antibody

Target Information

  • Target Protein: retrotransposon-like 1
  • Target Gene: RTL1
  • Alternative Gene Names: Mar1, MART1, PEG11

Product Description

Polyclonal antibody against human RTL1.
Produced in rabbit and affinity purified using a PrEST antigen.

  • ICC (Immunocytochemistry)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

WGVEEQEAFECLKRAFRKAPLLHHPKPQNPFYLETGVTGTALHASLIQIDDQTGKRACCAFYSRNISPIEVEYSQAEMKILPIRAAFMVWCRYLENTE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000048751 74%
Mouse ENSMUSG00000098639 74%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Store at recommended conditions; gently mix before use
Notes Optimal concentrations and conditions should be determined by the user.

Safety Information

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.