CacheBy
Atlas Antibodies Anti-RTL1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RTL1 Antibody

상품 한눈에 보기

휴먼 RTL1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. ICC 등 다양한 응용에 적합하며, PrEST 항원으로 친화 정제되었습니다. Human에 반응하며, Rat 및 Mouse와 74% 서열 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA066979-100 Anti-RTL1 Antibody, retrotransposon-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066979-25 Anti-RTL1 Antibody, retrotransposon-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RTL1 Antibody

Anti-RTL1 Antibody

Target Information

  • Target Protein: retrotransposon-like 1
  • Target Gene: RTL1
  • Alternative Gene Names: Mar1, MART1, PEG11

Product Description

Polyclonal antibody against human RTL1.
Produced in rabbit and affinity purified using a PrEST antigen.

  • ICC (Immunocytochemistry)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

WGVEEQEAFECLKRAFRKAPLLHHPKPQNPFYLETGVTGTALHASLIQIDDQTGKRACCAFYSRNISPIEVEYSQAEMKILPIRAAFMVWCRYLENTE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000048751 74%
Mouse ENSMUSG00000098639 74%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Store at recommended conditions; gently mix before use
Notes Optimal concentrations and conditions should be determined by the user.

Safety Information

Additional Resources

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.