CacheBy
Atlas Antibodies Anti-RRP9 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RRP9 Antibody

상품 한눈에 보기

Human RRP9 단백질을 인식하는 Rabbit Polyclonal 항체로, SSU processome 구성요소 연구에 적합. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 사용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038798-100 Anti-RRP9 Antibody, ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038798-25 Anti-RRP9 Antibody, ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RRP9 Antibody

Anti-RRP9 Antibody

Target: ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast)

  • Immunohistochemistry (IHC)

Product Description

Polyclonal Antibody against Human RRP9

Alternative Gene Names

  • RNU3IP2
  • U3-55K

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast)
Target Gene RRP9
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence THQLYSTSHDRSVKVWNVAENSYVETLFGHQDAVAALDALSRECCVTAGGRDGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALWGLSKKRPL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000041506 99%
Rat ENSRNOG00000012927 99%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.