
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RRP9 Antibody
상품 한눈에 보기
Human RRP9 단백질을 인식하는 Rabbit Polyclonal 항체로, SSU processome 구성요소 연구에 적합. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 사용 가능.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038798-100 Anti-RRP9 Antibody, ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038798-25 Anti-RRP9 Antibody, ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RRP9 Antibody
Anti-RRP9 Antibody
Target: ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast)
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal Antibody against Human RRP9
Alternative Gene Names
- RNU3IP2
- U3-55K
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ribosomal RNA processing 9, small subunit (SSU) processome component, homolog (yeast) |
| Target Gene | RRP9 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | THQLYSTSHDRSVKVWNVAENSYVETLFGHQDAVAALDALSRECCVTAGGRDGTVRVWKIPEESQLVFYGHQGSIDCIHLINEEHMVSGADDGSVALWGLSKKRPL |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000041506 | 99% |
| Rat | ENSRNOG00000012927 | 99% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



