CacheBy
Atlas Antibodies Anti-RRP8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RRP8 Antibody

상품 한눈에 보기

Human RRP8 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit에서 생산되었으며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응하며 보존성이 높은 ortholog와 유사성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA038487-100 Anti-RRP8 Antibody, ribosomal RNA processing 8, methyltransferase, homolog (yeast) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038487-25 Anti-RRP8 Antibody, ribosomal RNA processing 8, methyltransferase, homolog (yeast) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RRP8 Antibody

Anti-RRP8 Antibody

Target: ribosomal RNA processing 8, methyltransferase, homolog (yeast)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human RRP8.

Alternative Gene Names

  • KIAA0409

Open Datasheet

Target Information

  • Protein: ribosomal RNA processing 8, methyltransferase, homolog (yeast)
  • Gene: RRP8
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
AQRLFQEDPEAFLLYHRGFQSQVKKWPLQPVDRIARDLRQRPASLVVADFGCGDCRLASSIRNSVHCFDLASLDPRVTVCDMAQVPLEDESVDVAVFC

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Mouse ENSMUSG00000030888 93%
Rat ENSRNOG00000018766 92%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 대한 최적의 농도 및 조건은 사용자가 직접 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.