
Atlas Antibodies Anti-RPS6KL1 Antibody
Human RPS6KL1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC, WB, ICC에 적합합니다. 재조합 단백질 발현 검증 완료. 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. PBS 기반 완충액에 글리세롤과 나트륨 아지드 보존제가 포함되어 있습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RPS6KL1 Antibody
Target: ribosomal protein S6 kinase-like 1 (RPS6KL1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
- ICC (Immunocytochemistry)
Recombinant expression validation:
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human RPS6KL1
Alternative Gene Names
- MGC11287
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ribosomal protein S6 kinase-like 1 |
| Target Gene | RPS6KL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | WSFGSLLYELLTGMALSQSHPSGIQAHTQLQLPEWLSRPAASLLTELLQFEPTRRLGMGEGGVSKLKSHP |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일도 |
|---|---|---|
| Rat | ENSRNOG00000005530 | 90% |
| Mouse | ENSMUSG00000019235 | 89% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RPS6KC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS7 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS6KL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS6KC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS6KL1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|