
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RPS6KL1 Antibody
상품 한눈에 보기
Human RPS6KL1 단백질을 인식하는 폴리클로날 토끼 항체로, IHC, WB, ICC에 적합합니다. 재조합 단백질 발현 검증 완료. 친화 정제 방식으로 높은 특이성과 재현성을 제공합니다. PBS 기반 완충액에 글리세롤과 나트륨 아지드 보존제가 포함되어 있습니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA027451-100 Anti-RPS6KL1 Antibody, ribosomal protein S6 kinase-like 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA027451-25 Anti-RPS6KL1 Antibody, ribosomal protein S6 kinase-like 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RPS6KL1 Antibody
Anti-RPS6KL1 Antibody
Target: ribosomal protein S6 kinase-like 1 (RPS6KL1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
- ICC (Immunocytochemistry)
Recombinant expression validation:
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human RPS6KL1
Alternative Gene Names
- MGC11287
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ribosomal protein S6 kinase-like 1 |
| Target Gene | RPS6KL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | WSFGSLLYELLTGMALSQSHPSGIQAHTQLQLPEWLSRPAASLLTELLQFEPTRRLGMGEGGVSKLKSHP |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일도 |
|---|---|---|
| Rat | ENSRNOG00000005530 | 90% |
| Mouse | ENSMUSG00000019235 | 89% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



