
Atlas Antibodies Anti-RPS6KL1 Antibody
상품 한눈에 보기
인간 RPS6KL1 단백질을 표적으로 하는 폴리클로날 항체. IHC, WB(재조합 발현 검증), ICC에 적합. 토끼 유래 IgG로 제작되었으며, PrEST 항원으로 친화 정제됨. 인간 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RPS6KL1 Antibody
Target: ribosomal protein S6 kinase-like 1
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Recombinant expression validation using target protein overexpression
- Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human RPS6KL1
Alternative Gene Names
- MGC11287
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ribosomal protein S6 kinase-like 1 |
| Target Gene | RPS6KL1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | WSFGSLLYELLTGMALSQSHPSGIQAHTQLQLPEWLSRPAASLLTELLQFEPTRRLGMGEGGVSKLKSHP |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000005530 (90%)
- Mouse ENSMUSG00000019235 (89%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RPS6KL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS6KC1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS6KL1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS6KA6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RPS9 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.