Atlas Antibodies Anti-RPLP2 Antibody
| 상품 옵션 정보 | ||||||||
|---|---|---|---|---|---|---|---|---|
| 카탈로그 번호 | CAS 번호 | 설명 | 상태 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
| HPA053635-100 | - | Atlas Antibodies HPA053635-100 Anti-RPLP2 Antibody, ribosomal protein, large, P2 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | |
| HPA053635-25 | - | Atlas Antibodies HPA053635-25 Anti-RPLP2 Antibody, ribosomal protein, large, P2 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 | |
다른 상품 둘러보기
Anti-RPLP2 Antibody
ribosomal protein, large, P2
Recommended Applications
Product Description
Polyclonal Antibody against Human RPLP2
Alternative Gene Names
D11S2243E, LP2, MGC71408, P2, RPP2
Target Protein
ribosomal protein, large, P2
Target Gene
RPLP2
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVIS
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Mouse ENSMUSG00000025508 (100%)
Rat ENSRNOG00000038074 (95%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제 방법 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|