
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RPL8 Antibody
상품 한눈에 보기
Human RPL8 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human, Mouse, Rat에 반응.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050165-100 Anti-RPL8 Antibody, ribosomal protein L8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050165-25 Anti-RPL8 Antibody, ribosomal protein L8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RPL8 Antibody
Anti-RPL8 Antibody
Target: ribosomal protein L8
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
- WB (Genetic validation): Validation in Western blot by siRNA knockdown.
Product Description
Polyclonal antibody against Human RPL8.
Alternative Gene Names
- L8
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ribosomal protein L8 |
| Target Gene | RPL8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | LAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETK |
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Identity |
|---|---|---|
| Mouse | ENSMUSG00000003970 | 100% |
| Rat | ENSRNOG00000048523 | 100% |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (Sodium Azide)
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



