CacheBy
Atlas Antibodies Anti-RPL8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RPL8 Antibody

상품 한눈에 보기

Human RPL8 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. Human, Mouse, Rat에 반응.

카탈로그번호
HPA050165-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050165-100 Anti-RPL8 Antibody, ribosomal protein L8 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050165-25 Anti-RPL8 Antibody, ribosomal protein L8 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RPL8 Antibody

Anti-RPL8 Antibody

Target: ribosomal protein L8
Supplier: Atlas Antibodies


  • IHC (Independent validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Genetic validation): Validation in Western blot by siRNA knockdown.

Product Description

Polyclonal antibody against Human RPL8.


Alternative Gene Names

  • L8

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein ribosomal protein L8
Target Gene RPL8
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence LAKVVFRDPYRFKKRTELFIAAEGIHTGQFVYCGKKAQLNIGNVLPVGTMPEGTIVCCLEEKPGDRGKLARASGNYATVISHNPETK

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Identity
Mouse ENSMUSG00000003970 100%
Rat ENSRNOG00000048523 100%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent Validation
IHC Validation Tooltip
WB Genetic Validation
WB Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.