
Atlas Antibodies Anti-RPL3 Antibody
Human RPL3 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원으로 친화 정제되었으며, 높은 종간 보존성을 가집니다. 40% 글리세롤 기반 완충액에 보존되어 안정적입니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RPL3 Antibody
Target: ribosomal protein L3 (RPL3)
Clonality: Polyclonal
Host: Rabbit
Isotype: IgG
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human RPL3, also known as ribosomal protein L3.
Alternative gene name: L3
Antigen Information
Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
EDGKKQLEKDFSSMKKYCQVIRVIAHTQMRLLPLRQKKAHLMEIQVNGGTVAEKLDWARERLEQQVPVNQVFGQDEMIDVIGVTKGKGYKGVTSRWHTKKLPRKTHR
Verified Species Reactivity
- Human
Interspecies Information:
Highest antigen sequence identity to orthologs:
- Mouse (ENSMUSG00000060036) – 96%
- Rat (ENSRNOG00000016896) – 96%
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide as preservative
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 스펙 요약
| 항목 | 내용 |
|---|---|
| Target Protein | ribosomal protein L3 |
| Gene Symbol | RPL3 |
| Clonality | Polyclonal |
| Host | Rabbit |
| Isotype | IgG |
| Reactivity | Human |
| Ortholog Identity | Mouse 96%, Rat 96% |
| Purification | Affinity purified (PrEST antigen) |
| Buffer | 40% glycerol, PBS (pH 7.2), 0.02% sodium azide |
| Applications | IHC, WB, ICC |
| Datasheet | PDF 다운로드 |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
