CacheBy
Atlas Antibodies Anti-RPL28 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RPL28 Antibody

상품 한눈에 보기

인간 RPL28 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. siRNA knockdown을 통한 유전적 검증 완료. 높은 종 간 항원 일치율과 친화 정제 방식으로 고품질 신뢰성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050459-100 Anti-RPL28 Antibody, ribosomal protein L28 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050459-25 Anti-RPL28 Antibody, ribosomal protein L28 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RPL28 Antibody

Anti-RPL28 Antibody

Target: Ribosomal protein L28
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB) — Genetic validation by siRNA knockdown
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human RPL28.


Alternative Gene Names

FLJ43307, L28

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Ribosomal protein L28
Target Gene RPL28
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QRKPATSYVRTTINKNARATLSSIRHMIRKNKYRPDLRMAAIRRASAILRSQKPVMVKRKRT
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000017127 (98%), Mouse ENSMUSG00000030432 (98%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC
WB Genetic
Genetic Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.