Thermo Fisher Scientific Bone SialoProtein Polyclonal Antibody
Bone SialoProtein을 인식하는 Rabbit Polyclonal Antibody로, Human, Mouse, Rat 시료에 반응합니다. Western blot에 적합하며, 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 상태로 제공되며, PBS와 trehalose buffer에 재구성 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): 0.1–0.5 µg/mL
- View 1 publication
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Published Species | Mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human IBSP (FSMKNLHRRVKIEDSEENGVFKYRPRYYLYKHAYFYPHLKRFPVQ) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | -20°C |
| Shipping Conditions | Wet ice |
| RRID | AB_2746539 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is a major structural protein of the bone matrix. It constitutes approximately 12% of the noncollagenous proteins in human bone and is synthesized by skeletal-associated cell types, including hypertrophic chondrocytes, osteoblasts, osteocytes, and osteoclasts. The only extraskeletal site of its synthesis is the trophoblast. This protein binds to calcium and hydroxyapatite via its acidic amino acid clusters, and mediates cell attachment through an RGD sequence that recognizes the vitronectin receptor.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
제품 이미지
(이미지 정보가 제공되지 않았습니다.)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific Bone SialoProtein Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Bone SialoProtein Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific Bone SialoProtein Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HYAL1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific HYAL1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|