
Atlas Antibodies Anti-DDIT3 Antibody
상품 한눈에 보기
인간 DDIT3 단백질을 인식하는 토끼 폴리클로날 항체로, CHOP/GADD153 등 대체 유전자명과 연관됨. 면역세포화학 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. PBS/glycerol 완충액에 보존제로 sodium azide 포함.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DDIT3 Antibody
DNA-damage-inducible transcript 3
Recommended Applications
면역세포화학(ICC) 등 다양한 연구 응용에 적합합니다.
Product Description
Polyclonal antibody against human DDIT3.
Alternative Gene Names
CHOP, CHOP10, GADD153
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DNA-damage-inducible transcript 3 |
| Target Gene | DDIT3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000006789 (88%), Mouse ENSMUSG00000025408 (84%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
