AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DDIT3 Antibody
상품 한눈에 보기
인간 DDIT3 단백질을 인식하는 토끼 폴리클로날 항체로, CHOP/GADD153 등 대체 유전자명과 연관됨. 면역세포화학 등 다양한 응용에 적합하며, PrEST 항원을 이용해 친화 정제됨. PBS/glycerol 완충액에 보존제로 sodium azide 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA058416-100 Anti-DDIT3 Antibody, DNA-damage-inducible transcript 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA058416-25 Anti-DDIT3 Antibody, DNA-damage-inducible transcript 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DDIT3 Antibody
Anti-DDIT3 Antibody
DNA-damage-inducible transcript 3
Recommended Applications
면역세포화학(ICC) 등 다양한 연구 응용에 적합합니다.
Product Description
Polyclonal antibody against human DDIT3.
Alternative Gene Names
CHOP, CHOP10, GADD153
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DNA-damage-inducible transcript 3 |
| Target Gene | DDIT3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQ |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000006789 (88%), Mouse ENSMUSG00000025408 (84%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.