CacheBy
Atlas Antibodies Anti-DDI1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DDI1 Antibody

상품 한눈에 보기

인간 DDI1 단백질을 인식하는 고품질 폴리클로날 항체. IHC 및 RNA-seq 데이터 비교를 통한 정교한 Orthogonal 검증 제공. Rabbit 유래 IgG 형식으로 높은 특이성과 재현성 보장. Affinity purification으로 순도 향상.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA079511-100 Anti-DDI1 Antibody, DNA damage inducible 1 homolog 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA079511-25 Anti-DDI1 Antibody, DNA damage inducible 1 homolog 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DDI1 Antibody

Anti-DDI1 Antibody

DNA damage inducible 1 homolog 1


Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.


Product Description

Polyclonal Antibody against Human DDI1


Alternative Gene Names

FLJ36017

Open Datasheet


Target Information

항목 내용
Target Protein DNA damage inducible 1 homolog 1
Target Gene DDI1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PEGELPLCSRMVSGQDESSDKEITHSVMDSGRK
Verified Species Reactivity Human
Interspecies Information Mouse ENSMUSG00000047619 (56%), Rat ENSRNOG00000007371 (43%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
Recommended Application - IHC Orthogonal
Orthogonal Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.