CacheBy
Atlas Antibodies Anti-DCUN1D3 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-DCUN1D3 Antibody

상품 한눈에 보기

인간 DCUN1D3 단백질을 인식하는 폴리클로날 항체. 면역조직화학(IHC) 등 다양한 연구 응용에 적합. 토끼 유래 IgG 형식으로 제작되었으며, PrEST 항원 기반 친화 정제. 인간에 대해 검증된 반응성과 높은 종간 서열 동일성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA043511-100 Anti-DCUN1D3 Antibody, DCN1, defective in cullin neddylation 1, domain containing 3 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA043511-25 Anti-DCUN1D3 Antibody, DCN1, defective in cullin neddylation 1, domain containing 3 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-DCUN1D3 Antibody

Anti-DCUN1D3 Antibody

Target Protein: DCN1, defective in cullin neddylation 1, domain containing 3
Target Gene: DCUN1D3

면역조직화학 (IHC)

Product Description

Polyclonal antibody against human DCUN1D3.

Alternative Gene Names

DKFZp686O0290, FLJ41725, MGC48972

Open Datasheet

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

IALWKLVFTQNNPPVLDQWLNFLTENPSGIKGISRDTWNMFLNFTQVIGPDLSNYSEDEAWPSLFDTFVEWEMERRKR

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000048787 (100%)
  • Rat ENSRNOG00000014037 (100%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험에 따라 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.