
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-DCUN1D1 Antibody
상품 한눈에 보기
인간 DCUN1D1 단백질을 인식하는 토끼 폴리클로날 항체. IHC, WB, ICC 등 다양한 응용에 적합. 재조합 발현 검증 완료. 고순도 Affinity 정제 방식으로 제조. 글리세롤 및 PBS 완충액에 보존.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035911-100 Anti-DCUN1D1 Antibody, DCN1, defective in cullin neddylation 1, domain containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035911-25 Anti-DCUN1D1 Antibody, DCN1, defective in cullin neddylation 1, domain containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-DCUN1D1 Antibody
Anti-DCUN1D1 Antibody
DCN1, defective in cullin neddylation 1, domain containing 1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Recombinant expression validation using target protein overexpression
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human DCUN1D1.
Alternative Gene Names
DCUN1L1, RP42, SCCRO, SCRO, Tes3
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | DCN1, defective in cullin neddylation 1, domain containing 1 |
| Target Gene | DCUN1D1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence: RQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNR |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000012734 (100%) Mouse ENSMUSG00000027708 (98%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



