
Atlas Antibodies Anti-DARS2 Antibody
상품 한눈에 보기
Human DARS2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 독립적 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인체 DARS2 단백질 발현 연구에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-DARS2 Antibody
Target: aspartyl-tRNA synthetase 2, mitochondrial
Supplier: Atlas Antibodies
Type: Polyclonal Antibody against Human DARS2
Recommended Applications
- IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
- WB (Independent Validation): Validation of protein expression in western blot by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human DARS2, validated for multiple applications.
Alternative Gene Names
- FLJ10514
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | aspartyl-tRNA synthetase 2, mitochondrial |
| Target Gene | DARS2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | EVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKK |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000026709 (91%), Rat ENSRNOG00000002813 (88%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Reference
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
