Atlas Antibodies Anti-DARS2 Antibody

상품 한눈에 보기

Human DARS2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에서 독립적 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성을 제공. 인체 DARS2 단백질 발현 연구에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA026506-100 Anti-DARS2 Antibody, aspartyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA026506-25 Anti-DARS2 Antibody, aspartyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: aspartyl-tRNA synthetase 2, mitochondrial
Supplier: Atlas Antibodies
Type: Polyclonal Antibody against Human DARS2

IHC (Independent Validation): Validation of protein expression in immunohistochemistry by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in western blot by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human DARS2, validated for multiple applications.

항목	내용
Target Protein	aspartyl-tRNA synthetase 2, mitochondrial
Target Gene	DARS2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	EVTLCGWIQYRRQNTFLVLRDFDGLVQVIIPQDESAASVKKILCEAPVESVVQVSGTVISRPAGQENPKMPTGEIEIKVKTAELLNACKKLPFEIKNFVKK
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000026709 (91%), Rat ENSRNOG00000002813 (88%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet