Atlas Antibodies Anti-DARS Antibody

상품 한눈에 보기

Human DARS(aspartyl-tRNA synthetase)를 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합함. Rabbit에서 생산된 IgG 형식이며, PrEST 항원을 이용해 친화 정제됨. Human에 검증된 반응성을 가지며, 높은 ortholog 일치율을 보임.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029805-100 Anti-DARS Antibody, aspartyl-tRNA synthetase 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029805-25 Anti-DARS Antibody, aspartyl-tRNA synthetase 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-DARS Antibody

Anti-DARS Antibody

Target: Aspartyl-tRNA synthetase
Supplier: Atlas Antibodies

Recommended Applications

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Independent Validation): Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC

Product Description

Polyclonal antibody against Human DARS.

Open Datasheet

Target Information

항목	내용
Target Protein	Aspartyl-tRNA synthetase
Target Gene	DARS
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	LHVQKIYVISLAEPRLPLQLDDAVRPEAEGEEEGRATVNQDTRLDNRVIDLRTSTSQAVFRLQSGICHLFRETLINKGFVEIQTPKIISAASEGGANVFTVSYFKNNAYLAQSPQLYKQMCICAD
Verified Species Reactivity	Human
Interspecies Information	Mouse ENSMUSG00000026356 (97%), Rat ENSRNOG00000003743 (94%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.