
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CTTN Antibody
상품 한눈에 보기
Human CTTN(cortactin)을 인식하는 rabbit polyclonal antibody로, IHC, WB, ICC에 적합합니다. Affinity purified 방식으로 제조되며, 높은 종간 보존성을 보입니다. 40% glycerol 기반 PBS buffer에 보관됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA057242-100 Anti-CTTN Antibody, cortactin 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA057242-25 Anti-CTTN Antibody, cortactin 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CTTN Antibody
Anti-CTTN Antibody
Target Information
- Target Protein: cortactin
- Target Gene: CTTN
- Alternative Gene Names: EMS1
Product Description
Polyclonal antibody against human CTTN (cortactin).
Recommended for use in immunohistochemistry (IHC), western blot (WB), and immunocytochemistry (ICC).
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGF
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat: ENSRNOG00000047280 (97%)
- Mouse: ENSMUSG00000031078 (96%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage Note | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Reference Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



