Atlas Antibodies Anti-CTTN Antibody

상품 한눈에 보기

Human CTTN(cortactin)을 인식하는 rabbit polyclonal antibody로, IHC, WB, ICC에 적합합니다. Affinity purified 방식으로 제조되며, 높은 종간 보존성을 보입니다. 40% glycerol 기반 PBS buffer에 보관됩니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA057242-100 Anti-CTTN Antibody, cortactin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA057242-25 Anti-CTTN Antibody, cortactin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-CTTN Antibody

Anti-CTTN Antibody

Target Information

Target Protein: cortactin
Target Gene: CTTN
Alternative Gene Names: EMS1

Product Description

Polyclonal antibody against human CTTN (cortactin).
Recommended for use in immunohistochemistry (IHC), western blot (WB), and immunocytochemistry (ICC).

Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence:
GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGF

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat: ENSRNOG00000047280 (97%)
Mouse: ENSMUSG00000031078 (96%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Storage Note	Gently mix before use. Optimal concentrations and conditions should be determined by the user.