
Atlas Antibodies Anti-CTTN Antibody
상품 한눈에 보기
Human CTTN(cortactin)을 인식하는 rabbit polyclonal antibody로, IHC, WB, ICC에 적합합니다. Affinity purified 방식으로 제조되며, 높은 종간 보존성을 보입니다. 40% glycerol 기반 PBS buffer에 보관됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CTTN Antibody
Target Information
- Target Protein: cortactin
- Target Gene: CTTN
- Alternative Gene Names: EMS1
Product Description
Polyclonal antibody against human CTTN (cortactin).
Recommended for use in immunohistochemistry (IHC), western blot (WB), and immunocytochemistry (ICC).
Antigen Information
- Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
- Sequence:
GFGGKFGVQTDRQDKCALGWDHQEKLQLHESQKDYKTGFGGKFGVQSERQDSAAVGFDYKEKLAKHESQQDYSKGF
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat: ENSRNOG00000047280 (97%)
- Mouse: ENSMUSG00000031078 (96%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Storage Note | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Reference Documents
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CTSZ Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTXN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTTN Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTTNBP2NL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTU1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.