CacheBy
Atlas Antibodies Anti-CTTNBP2NL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CTTNBP2NL Antibody

상품 한눈에 보기

Human CTTNBP2NL 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 보존성을 보입니다. PBS/glycerol buffer에 보관되며, 사용 전 부드럽게 혼합하십시오.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA007301-100 Anti-CTTNBP2NL Antibody, CTTNBP2 N-terminal like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA007301-25 Anti-CTTNBP2NL Antibody, CTTNBP2 N-terminal like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CTTNBP2NL Antibody

Anti-CTTNBP2NL Antibody

CTTNBP2 N-terminal like

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human CTTNBP2NL.

Alternative Gene Names

  • DKFZp547A023

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein CTTNBP2 N-terminal like
Target Gene CTTNBP2NL
Antigen Sequence Type Recombinant Protein Epitope Signature Tag (PrEST)

Antigen Sequence:

NPLSILKVVMKQCKNMQERMLSQLAAAESRHRKVILDLEEERQRHAQDTAEGDDVTYMLEKERERLTQQLEFEKSQVKKFEKEQKKLSSQLEEERSRHKQLSSMLVLECKKATNKAAEEGQKAGELSLKLEKEKSRVSKLEEELAAERKR

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000014479 98%
Mouse ENSMUSG00000062127 95%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.