
Atlas Antibodies Anti-CTSO Antibody
상품 한눈에 보기
Human CTSO를 표적으로 하는 Rabbit Polyclonal Antibody로, IHC와 WB에 적합. PrEST 항원을 이용해 Affinity Purified. 40% glycerol, PBS buffer 및 sodium azide 보존제 포함. Human에 대한 반응성 검증 완료.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CTSO Antibody
Target Information
- Target Protein: Cathepsin O
- Target Gene: CTSO
- Alternative Gene Names: CTSO1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal antibody against human CTSO, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
QFSYLFPEEFKAIYLRSKPSKFPRYSAEVHMSIPNVSLPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTL
Verified Species Reactivity
- Human
Interspecies Information
| Species | Gene ID | Sequence Identity |
|---|---|---|
| Mouse | ENSMUSG00000028015 | 75% |
| Rat | ENSRNOG00000040000 | 40% |
Antibody Properties
| Property | Description |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
Material Safety Data Sheet: MSDS - Sodium Azide
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CTTNBP2NL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTU1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTSO Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTSS Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTSZ Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.