CacheBy
Atlas Antibodies Anti-CTSO Antibody
원본

Atlas Antibodies Anti-CTSO Antibody

상품 한눈에 보기

Human CTSO를 표적으로 하는 Rabbit Polyclonal Antibody로, IHC와 WB에 적합. PrEST 항원을 이용해 Affinity Purified. 40% glycerol, PBS buffer 및 sodium azide 보존제 포함. Human에 대한 반응성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA002041-100 Anti-CTSO Antibody, cathepsin O 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA002041-25 Anti-CTSO Antibody, cathepsin O 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CTSO Antibody

Anti-CTSO Antibody

Target Information

  • Target Protein: Cathepsin O
  • Target Gene: CTSO
  • Alternative Gene Names: CTSO1
  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human CTSO, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

QFSYLFPEEFKAIYLRSKPSKFPRYSAEVHMSIPNVSLPLRFDWRDKQVVTQVRNQQMCGGCWAFSVVGAVESAYAIKGKPLEDLSVQQVIDCSYNNYGCNGGSTL

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000028015 75%
Rat ENSRNOG00000040000 40%

Antibody Properties

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), with 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen

Material Safety Data Sheet: MSDS - Sodium Azide

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.