AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CTSL Antibody
상품 한눈에 보기
Human CTSL 단백질을 인식하는 Rabbit Polyclonal 항체로, Western Blot과 Immunocytochemistry에 적합합니다. PrEST 항원으로 정제되었으며, 높은 특이성과 재현성을 제공합니다. Human에 대한 반응성이 검증되었습니다.
- 카탈로그번호
- HPA070413-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA070413-100 Anti-CTSL Antibody, cathepsin L 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA070413-25 Anti-CTSL Antibody, cathepsin L 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CTSL Antibody
Anti-CTSL Antibody
Target Information
- Target Protein: Cathepsin L
- Target Gene: CTSL
- Alternative Gene Names: CTSL1, FLJ31037
Product Description
Polyclonal antibody against human cathepsin L (CTSL).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended Applications
- Western Blot (WB)
- Immunocytochemistry (ICC)
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:GIASATLTFDHSLEAQWTKWKAMHNRLYGM
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000018566 (53%)
- Mouse ENSMUSG00000021477 (50%)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide |
| Purification Method | Affinity purified using PrEST antigen |
| Preservative | Sodium azide (0.02%) |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.