CacheBy
Atlas Antibodies Anti-CTSG Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CTSG Antibody

상품 한눈에 보기

Human CTSG(cathepsin G) 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증 완료. Affinity purification 방식으로 고순도 확보. Human에 대한 반응성 검증 완료. 40% glycerol 기반 PBS buffer에 보존제 포함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA047737-100 Anti-CTSG Antibody, cathepsin G 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA047737-25 Anti-CTSG Antibody, cathepsin G 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CTSG Antibody

Anti-CTSG Antibody

Target: cathepsin G

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human CTSG

Alternative Gene Names

  • CG

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein cathepsin G
Target Gene CTSG
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence GRVSMRRGTDTLREVQLRVQRDRQCLRIFGSYDPRRQICVGDRRERKAAFK

Verified Species Reactivity

  • Human

Interspecies Information

Ortholog ID Sequence Identity
Mouse ENSMUSG00000040314 59%
Rat ENSRNOG00000020647 59%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.