CacheBy
Atlas Antibodies Anti-CTSK Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CTSK Antibody

상품 한눈에 보기

사람 CTSK 단백질을 인식하는 토끼 폴리클로날 항체로, cathepsin K 연구용에 적합함. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증됨. 면역세포화학 등 다양한 응용에 추천됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA050346-100 Anti-CTSK Antibody, cathepsin K 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050346-25 Anti-CTSK Antibody, cathepsin K 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CTSK Antibody

Anti-CTSK Antibody

Target Information

  • Target Protein: Cathepsin K
  • Target Gene: CTSK
  • Alternative Gene Names: CTSO, CTSO2, PKND, PYCD

Product Description

Polyclonal antibody against human CTSK (Cathepsin K), generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000021155 (85%)
  • Mouse ENSMUSG00000028111 (83%)
  • Immunocytochemistry (ICC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Gently mix before use. Optimal concentrations and conditions should be determined by the user.

Reference Documents

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.