
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CTSK Antibody
상품 한눈에 보기
사람 CTSK 단백질을 인식하는 토끼 폴리클로날 항체로, cathepsin K 연구용에 적합함. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증됨. 면역세포화학 등 다양한 응용에 추천됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050346-100 Anti-CTSK Antibody, cathepsin K 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050346-25 Anti-CTSK Antibody, cathepsin K 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CTSK Antibody
Anti-CTSK Antibody
Target Information
- Target Protein: Cathepsin K
- Target Gene: CTSK
- Alternative Gene Names: CTSO, CTSO2, PKND, PYCD
Product Description
Polyclonal antibody against human CTSK (Cathepsin K), generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000021155 (85%)
- Mouse ENSMUSG00000028111 (83%)
Recommended Applications
- Immunocytochemistry (ICC)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Reference Documents
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



