Atlas Antibodies Anti-CTSK Antibody
상품 한눈에 보기
사람 CTSK 단백질을 인식하는 토끼 폴리클로날 항체로, cathepsin K 연구용에 적합함. PrEST 항원을 이용해 친화 정제되었으며, 인간에 대해 검증됨. 면역세포화학 등 다양한 응용에 추천됨.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CTSK Antibody
Target Information
- Target Protein: Cathepsin K
- Target Gene: CTSK
- Alternative Gene Names: CTSO, CTSO2, PKND, PYCD
Product Description
Polyclonal antibody against human CTSK (Cathepsin K), generated in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:LAVGYGIQKGNKHWIIKNSWGENWGNKGYILMARNKNNACGIANLASF
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000021155 (85%)
- Mouse ENSMUSG00000028111 (83%)
Recommended Applications
- Immunocytochemistry (ICC)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage | Gently mix before use. Optimal concentrations and conditions should be determined by the user. |
Reference Documents
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.