
Atlas Antibodies Anti-CTRL Antibody
상품 한눈에 보기
Human CTRL 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB 검증에 적합합니다. Orthogonal validation과 recombinant expression 검증을 통해 신뢰성 높은 결과를 제공합니다. Rabbit 호스트에서 생산되었으며, PrEST 항원으로 친화 정제되었습니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CTRL Antibody
Target Protein: chymotrypsin-like
Supplier: Atlas Antibodies
Recommended Applications
IHC Orthogonal Validation
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.WB Recombinant Expression Validation
Recombinant expression validation in WB using target protein overexpression.
Product Description
Polyclonal Antibody against Human CTRL
Open Datasheet (PDF)
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | chymotrypsin-like |
| Target Gene | CTRL |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNSTTMNNDVTLLK |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000019353 (84%), Mouse ENSMUSG00000031896 (84%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.
