CacheBy
Atlas Antibodies Anti-CTPS1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CTPS1 Antibody

상품 한눈에 보기

Human CTPS1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC 응용에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 단백질 발현 비교 검증이 완료되었습니다. 고순도의 Affinity purification 방식으로 제조되었습니다.

카탈로그번호
HPA051322-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051322-100 Anti-CTPS1 Antibody, CTP synthase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051322-25 Anti-CTPS1 Antibody, CTP synthase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CTPS1 Antibody

Anti-CTPS1 Antibody

CTP synthase 1

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)
  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal antibody against Human CTPS1.

Alternative Gene Names

  • CTPS

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein CTP synthase 1
Target Gene CTPS1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence PYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
Verified Species Reactivity Human
Interspecies Identity Rat (94%), Mouse (94%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

항목 내용
Buffer Composition 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.