
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-CTB-50L17.10 Antibody
상품 한눈에 보기
Human CTB-50L17.10 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 인체에서 검증된 반응성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044208-100 Anti-CTB-50L17.10 Antibody, Hepatoma-derived growth factor-related protein 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044208-25 Anti-CTB-50L17.10 Antibody, Hepatoma-derived growth factor-related protein 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CTB-50L17.10 Antibody
Anti-CTB-50L17.10 Antibody
Target: Hepatoma-derived growth factor-related protein 2 (CTB-50L17.10)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Independent antibody validation comparing different epitopes of the same protein.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human CTB-50L17.10.
Validated for use in IHC and ICC applications.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Hepatoma-derived growth factor-related protein 2 |
| Target Gene | CTB-50L17.10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000049142 (78%), Mouse ENSMUSG00000002833 (77%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 실험 조건에 맞는 최적 농도는 사용자가 직접 결정해야 합니다.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



