
Atlas Antibodies Anti-CTB-50L17.10 Antibody
상품 한눈에 보기
Human CTB-50L17.10 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 인체에서 검증된 반응성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CTB-50L17.10 Antibody
Target: Hepatoma-derived growth factor-related protein 2 (CTB-50L17.10)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry) – Independent antibody validation comparing different epitopes of the same protein.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human CTB-50L17.10.
Validated for use in IHC and ICC applications.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Hepatoma-derived growth factor-related protein 2 |
| Target Gene | CTB-50L17.10 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALK |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000049142 (78%), Mouse ENSMUSG00000002833 (77%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 실험 조건에 맞는 최적 농도는 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CTBP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTB-50L17.10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CT45A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTB-133G6.1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.