Atlas Antibodies Anti-CTB-50L17.10 Antibody

상품 한눈에 보기

Human CTB-50L17.10 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며, 인체에서 검증된 반응성을 보입니다. 40% 글리세롤 및 PBS 완충액에 보존되어 안정적입니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA044208-100 Anti-CTB-50L17.10 Antibody, Hepatoma-derived growth factor-related protein 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA044208-25 Anti-CTB-50L17.10 Antibody, Hepatoma-derived growth factor-related protein 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: Hepatoma-derived growth factor-related protein 2 (CTB-50L17.10)
Supplier: Atlas Antibodies

IHC (Immunohistochemistry) – Independent antibody validation comparing different epitopes of the same protein.
ICC (Immunocytochemistry)

Polyclonal antibody against human CTB-50L17.10.
Validated for use in IHC and ICC applications.

항목	내용
Target Protein	Hepatoma-derived growth factor-related protein 2
Target Gene	CTB-50L17.10
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	AKKSAKKPQSSSTEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHSEIKFALK
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000049142 (78%), Mouse ENSMUSG00000002833 (77%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2) with 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand