CacheBy
Atlas Antibodies Anti-CT45A1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-CT45A1 Antibody

상품 한눈에 보기

Human CT45A1 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 정합 검증 완료. Rabbit 유래 IgG, PrEST 항원을 이용한 친화 정제. 암/고환 항원 연구 및 발현 분석에 적합.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA046987-100 Anti-CT45A1 Antibody, cancer/testis antigen family 45, member A1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA046987-25 Anti-CT45A1 Antibody, cancer/testis antigen family 45, member A1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-CT45A1 Antibody

Anti-CT45A1 Antibody

Target: cancer/testis antigen family 45, member A1
Supplier: Atlas Antibodies


  • IHC (Orthogonal validation): Protein expression validated using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
  • WB (Orthogonal validation): Protein expression validated using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
  • ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal Antibody against Human CT45A1


Alternative Gene Names

CT45-1, CT45.1

Open Datasheet (PDF)


Specifications

항목 내용
Target Protein cancer/testis antigen family 45, member A1
Target Gene CT45A1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence TEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSK
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000009873 (30%), Mouse ENSMUSG00000035161 (30%)
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Notes Gently mix before use. Optimal concentrations and conditions should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal
WB Orthogonal
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.