Atlas Antibodies Anti-CT45A1 Antibody

상품 한눈에 보기

Human CT45A1 단백질을 인식하는 고품질 폴리클로날 항체로, IHC 및 WB에서 RNA-seq 데이터 기반 정합 검증 완료. Rabbit 유래 IgG, PrEST 항원을 이용한 친화 정제. 암/고환 항원 연구 및 발현 분석에 적합.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA046987-100 Anti-CT45A1 Antibody, cancer/testis antigen family 45, member A1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA046987-25 Anti-CT45A1 Antibody, cancer/testis antigen family 45, member A1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: cancer/testis antigen family 45, member A1
Supplier: Atlas Antibodies

IHC (Orthogonal validation): Protein expression validated using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB (Orthogonal validation): Protein expression validated using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
ICC: Suitable for immunocytochemistry applications.

Polyclonal Antibody against Human CT45A1

CT45-1, CT45.1

항목	내용
Target Protein	cancer/testis antigen family 45, member A1
Target Gene	CT45A1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	TEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSK
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000009873 (30%), Mouse ENSMUSG00000035161 (30%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions should be determined by the user.