Atlas Antibodies Anti-CT45A1 Antibody
상품 한눈에 보기
인체 CT45A1 단백질을 표적으로 하는 폴리클로날 항체. IHC 및 WB에서 RNA-seq 데이터 기반의 Orthogonal Validation 수행. Rabbit 유래 IgG 항체로 고순도 Affinity 정제. 암/고환 항원 연구 및 단백질 발현 분석에 적합.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CT45A1 Antibody
Target: cancer/testis antigen family 45, member A1
Supplier: Atlas Antibodies
Recommended Applications
- IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB Orthogonal Validation: Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
- ICC: Immunocytochemistry application supported.
Product Description
Polyclonal Antibody against Human CT45A1
Alternative Gene Names
CT45-1, CT45.1
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cancer/testis antigen family 45, member A1 |
| Target Gene | CT45A1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000009873 (30%), Mouse ENSMUSG00000035161 (30%) |
Antigen Sequence:
TEKVAVDPETVFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSK
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Atlas Antibodies
Atlas Antibodies Anti-CTB-133G6.1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CTB-50L17.10 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CT45A1 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CTAGE5 Antibody
528,000원
Atlas Antibodies
Atlas Antibodies Anti-CTAG2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.