원본

Atlas Antibodies Anti-CTAG2 Antibody

상품 한눈에 보기

인간 CTAG2 단백질에 대한 폴리클로날 항체로, IHC에서 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증에 적합함. Rabbit 유래 IgG 항체이며, PrEST 항원 기반 친화 정제 방식으로 고순도 확보. 암/고환 항원 연구용으로 추천됨.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA071467-100 Anti-CTAG2 Antibody, cancer/testis antigen 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA071467-25 Anti-CTAG2 Antibody, cancer/testis antigen 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: cancer/testis antigen 2
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Polyclonal antibody against Human CTAG2.

CAMEL, CT6.2a, CT6.2b, ESO2, LAGE-1, LAGE-1a, LAGE-1b, LAGE1, MGC138724, MGC3803

항목	내용
Target Protein	cancer/testis antigen 2
Target Gene	CTAG2
Antigen Sequence Type	Recombinant Protein Epitope Signature Tag (PrEST)
Antigen Sequence	AQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPL

Human

Highest antigen sequence identity to the following orthologs:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand