
Atlas Antibodies Anti-CTAG2 Antibody
인간 CTAG2 단백질에 대한 폴리클로날 항체로, IHC에서 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증에 적합함. Rabbit 유래 IgG 항체이며, PrEST 항원 기반 친화 정제 방식으로 고순도 확보. 암/고환 항원 연구용으로 추천됨.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-CTAG2 Antibody
Target: cancer/testis antigen 2
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human CTAG2.
Alternative Gene Names
CAMEL, CT6.2a, CT6.2b, ESO2, LAGE-1, LAGE-1a, LAGE-1b, LAGE1, MGC138724, MGC3803
Antigen and Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cancer/testis antigen 2 |
| Target Gene | CTAG2 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | AQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPL |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000009139 (32%)
- Mouse ENSMUSG00000048573 (30%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-CT45A1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTAGE5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTAG2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CTAGE5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-CT55 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|