
원본
Atlas Antibodies Anti-CTAG2 Antibody
상품 한눈에 보기
인간 CTAG2 단백질에 대한 폴리클로날 항체로, IHC에서 RNA-seq 데이터 비교를 통한 정교한 단백질 발현 검증에 적합함. Rabbit 유래 IgG 항체이며, PrEST 항원 기반 친화 정제 방식으로 고순도 확보. 암/고환 항원 연구용으로 추천됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA071467-100 Anti-CTAG2 Antibody, cancer/testis antigen 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA071467-25 Anti-CTAG2 Antibody, cancer/testis antigen 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-CTAG2 Antibody
Anti-CTAG2 Antibody
Target: cancer/testis antigen 2
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal antibody against Human CTAG2.
Alternative Gene Names
CAMEL, CT6.2a, CT6.2b, ESO2, LAGE-1, LAGE-1a, LAGE-1b, LAGE1, MGC138724, MGC3803
Antigen and Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | cancer/testis antigen 2 |
| Target Gene | CTAG2 |
| Antigen Sequence Type | Recombinant Protein Epitope Signature Tag (PrEST) |
| Antigen Sequence | AQDGRCPCGARRPDSRLLQLHITMPFSSPMEAELVRRILSRDAAPL |
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000009139 (32%)
- Mouse ENSMUSG00000048573 (30%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Material Safety Data Sheet (MSDS)
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



