Atlas Antibodies Anti-RING1 Antibody
상품 한눈에 보기
Human RING1 단백질을 인식하는 폴리클로날 항체로, IHC, WB(재조합 발현), ICC 실험에 적합. Rabbit 유래 IgG 항체이며, PrEST 항원으로 친화 정제됨. 인체 반응성이 검증된 고품질 연구용 항체.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RING1 Antibody
Target Protein: ring finger protein 1
Alternative Gene Names: RNF1
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Recombinant expression validation using target protein overexpression
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human RING1.
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | ring finger protein 1 |
| Target Gene | RING1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (95%), Rat (94%) |
Antigen Sequence:
TRYVKTTGNATVDHLSKYLALRIALERRQQQEAGEPGGPGGGASDTGGPDGCGGEGGGAGGGDGPEEPALPSLEGVSEKQYTIYIAPGGGAFTTLNGSLTLELVNEKFWKVS
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes:
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
Open Datasheet
Material Safety Data Sheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.