CacheBy
Atlas Antibodies Anti-RIMS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RIMS2 Antibody

상품 한눈에 보기

Human RIMS2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC와 RNA-seq 데이터 비교를 통한 정교한 검증 수행. 고순도 친화 정제 방식으로 제조되며, 신경 시냅스막 소포 방출 조절 연구에 적합. Human, Rat, Mouse 종에 반응.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA066498-100 Anti-RIMS2 Antibody, regulating synaptic membrane exocytosis 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA066498-25 Anti-RIMS2 Antibody, regulating synaptic membrane exocytosis 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RIMS2 Antibody

Anti-RIMS2 Antibody

Target: regulating synaptic membrane exocytosis 2
Supplier: Atlas Antibodies


  • Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human RIMS2


Alternative Gene Names

KIAA0751, OBOE, RAB3IP3, RIM2

Open Datasheet


Target Information

항목 내용
Target Protein regulating synaptic membrane exocytosis 2
Target Gene RIMS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MDIEERNRQMKINKYKQVAGSDPRLEQDYHSKYRSGWDPHRGADNVSTKSS
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000004201 (96%), Mouse ENSMUSG00000037386 (96%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.