Atlas Antibodies Anti-RGN Antibody

상품 한눈에 보기

인체 RGN 단백질을 타겟으로 하는 폴리클로날 항체로, IHC 및 WB 검증을 통해 신뢰성 확보. Rabbit 호스트에서 생산되었으며 정제된 IgG 항체. Human에 반응하며 높은 종간 서열 일치율을 가짐.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA029102-100 Anti-RGN Antibody, regucalcin 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA029102-25 Anti-RGN Antibody, regucalcin 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target Protein: regucalcin
Product Type: Polyclonal Antibody against Human RGN
Supplier: Atlas Antibodies

IHC Orthogonal Validation: Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
WB Independent Validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC: Suitable for immunocytochemistry.

RC, SMP30

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Sequence:

ALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMC

Human

Species	Gene ID	Sequence Identity
Mouse	ENSMUSG00000023070	92%
Rat	ENSRNOG00000007949	91%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand