CacheBy
Atlas Antibodies Anti-RGP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RGP1 Antibody

상품 한눈에 보기

Human RGP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC 응용에 적합. 고순도 Affinity 정제 방식으로 제조되었으며, 높은 종간 보존성과 재현성 제공. RGP1 단백질 연구 및 골지체 역행 수송 기전 분석에 유용.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA020414-100 Anti-RGP1 Antibody, RGP1 retrograde golgi transport homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA020414-25 Anti-RGP1 Antibody, RGP1 retrograde golgi transport homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RGP1 Antibody

Anti-RGP1 Antibody

RGP1 retrograde golgi transport homolog (S. cerevisiae)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human RGP1.

Alternative Gene Names

  • KIAA0258

Open Datasheet

Target Information

항목 내용
Target Protein RGP1 retrograde golgi transport homolog (S. cerevisiae)
Target Gene RGP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence MIEVVAELSRGPVFLAGEALECVVTVTNPLPPTATSASSEALAWASAQIHCQFHASESRVALPPPDSSQPDVQPDSQTVFLPHRGERGQCILSTPP

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000016309 (100%)
  • Mouse ENSMUSG00000028468 (100%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.