원본

Atlas Antibodies Anti-RERE Antibody

상품 한눈에 보기

Human RERE 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC 및 WB에 적합합니다. 높은 종간 반응성(인간, 생쥐, 랫드)과 Affinity Purified 품질을 제공합니다. 연구용으로 안정적인 PBS/glycerol buffer에 보존됩니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA024093-100 Anti-RERE Antibody, arginine-glutamic acid dipeptide (RE) repeats 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA024093-25 Anti-RERE Antibody, arginine-glutamic acid dipeptide (RE) repeats 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-RERE Antibody

Anti-RERE Antibody

arginine-glutamic acid dipeptide (RE) repeats

Recommended Applications

Immunohistochemistry (IHC)
Western Blot (WB)

Product Description

Polyclonal Antibody against Human RERE

Alternative Gene Names

ARG, ARP, ATN1L, DNB1, KIAA0458

Open Datasheet

Target Information

항목	내용
Target Protein	arginine-glutamic acid dipeptide (RE) repeats
Target Gene	RERE
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

Epitope Sequence:
MCDGGSTEDGCVAASRDDTTLNALNTLHESGYDAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRKELLPNKETGELITFYYYWKKTPEAASSRAHRRHRRQAVFRRIKTRTASTPVNTPSR

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000017940 (99%)
Mouse ENSMUSG00000039852 (99%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative.
Purification Method	Affinity purified using the PrEST antigen as affinity ligand