
Atlas Antibodies Anti-RERE Antibody
Human RERE 단백질을 표적으로 하는 Rabbit Polyclonal Antibody로, IHC 및 WB에 적합합니다. 높은 종간 반응성(인간, 생쥐, 랫드)과 Affinity Purified 품질을 제공합니다. 연구용으로 안정적인 PBS/glycerol buffer에 보존됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RERE Antibody
arginine-glutamic acid dipeptide (RE) repeats
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Product Description
Polyclonal Antibody against Human RERE
Alternative Gene Names
ARG, ARP, ATN1L, DNB1, KIAA0458
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | arginine-glutamic acid dipeptide (RE) repeats |
| Target Gene | RERE |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
Epitope Sequence:
MCDGGSTEDGCVAASRDDTTLNALNTLHESGYDAGKALQRLVKKPVPKLIEKCWTEDEVKRFVKGLRQYGKNFFRIRKELLPNKETGELITFYYYWKKTPEAASSRAHRRHRRQAVFRRIKTRTASTPVNTPSR
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000017940 (99%)
- Mouse ENSMUSG00000039852 (99%)
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-REV3L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RETNLB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RERE Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RESP18 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-REPIN1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|