CacheBy
Atlas Antibodies Anti-REPIN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-REPIN1 Antibody

상품 한눈에 보기

Human REPIN1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되었으며, 높은 특이성과 재현성을 제공. PBS/glycerol buffer에 보존됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036022-100 Anti-REPIN1 Antibody, replication initiator 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036022-25 Anti-REPIN1 Antibody, replication initiator 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-REPIN1 Antibody

Anti-REPIN1 Antibody

Target Information

  • Target Protein: Replication initiator 1
  • Target Gene: REPIN1
  • Alternative Gene Names: AP4, H_DJ0584D14.12, RIP60, Zfp464, ZNF464

Product Description

Polyclonal antibody against human REPIN1.
Produced in rabbit and affinity purified using the PrEST antigen as ligand.
Suitable for use in immunohistochemistry (IHC), western blot (WB), and immunocytochemistry (ICC).

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWVALWLHTRRCQARLPLPCPE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000008239 (74%)
  • Mouse ENSMUSG00000052751 (72%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Recommended Applications IHC, WB, ICC
Storage Note Gently mix before use. Determine optimal concentrations and conditions experimentally.

References

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.