Atlas Antibodies Anti-REPIN1 Antibody

상품 한눈에 보기

Human REPIN1 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산됨. IHC, WB, ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되었으며, 높은 특이성과 재현성을 제공. PBS/glycerol buffer에 보존됨.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA036022-100 Anti-REPIN1 Antibody, replication initiator 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA036022-25 Anti-REPIN1 Antibody, replication initiator 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-REPIN1 Antibody

Anti-REPIN1 Antibody

Target Information

Target Protein: Replication initiator 1
Target Gene: REPIN1
Alternative Gene Names: AP4, H_DJ0584D14.12, RIP60, Zfp464, ZNF464

Product Description

Polyclonal antibody against human REPIN1.
Produced in rabbit and affinity purified using the PrEST antigen as ligand.
Suitable for use in immunohistochemistry (IHC), western blot (WB), and immunocytochemistry (ICC).

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

MLERRCRGPLAMGLAQPRLLSGPSQESPQTLGKESRGLRQQGTSVAQSGAQAPGRAHRCAHCRRHFPGWVALWLHTRRCQARLPLPCPE

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat ENSRNOG00000008239 (74%)
Mouse ENSMUSG00000052751 (72%)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Recommended Applications	IHC, WB, ICC
Storage Note	Gently mix before use. Determine optimal concentrations and conditions experimentally.