CacheBy
Atlas Antibodies Anti-RCN2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RCN2 Antibody

상품 한눈에 보기

Human RCN2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. 독립 항체 비교를 통한 단백질 발현 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA030695-100 Anti-RCN2 Antibody, reticulocalbin 2, EF-hand calcium binding domain 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030695-25 Anti-RCN2 Antibody, reticulocalbin 2, EF-hand calcium binding domain 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RCN2 Antibody

Anti-RCN2 Antibody

Target: reticulocalbin 2, EF-hand calcium binding domain
Supplier: Atlas Antibodies


  • IHC (Independent antibody validation)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
  • WB (Western Blot)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody against Human RCN2


Alternative Gene Names

E6BP, ERC-55, ERC55, TCBP49

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein reticulocalbin 2, EF-hand calcium binding domain
Target Gene RCN2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence AEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDK

Species Reactivity

Verified Species Human, Mouse
Interspecies Information Mouse ENSMUSG00000032320 (91%)
Rat ENSRNOG00000015780 (90%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Independent
Tooltip Independent
WB
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.