Atlas Antibodies Anti-RCN2 Antibody
상품 한눈에 보기
Human RCN2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 실험에 적합합니다. 독립 항체 비교를 통한 단백질 발현 검증 완료. Affinity purification 방식으로 높은 특이성과 재현성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RCN2 Antibody
Target: reticulocalbin 2, EF-hand calcium binding domain
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent antibody validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein. - WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against Human RCN2
Alternative Gene Names
E6BP, ERC-55, ERC55, TCBP49
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | reticulocalbin 2, EF-hand calcium binding domain |
| Target Gene | RCN2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | AEELHYPLGERRSDYDREALLGVQEDVDEYVKLGHEEQQKRLQAIIKKIDLDSDGFLTESELSSWIQMSFKHYAMQEAKQQFVEYDK |
Species Reactivity
| Verified Species | Human, Mouse |
|---|---|
| Interspecies Information | Mouse ENSMUSG00000032320 (91%) Rat ENSRNOG00000015780 (90%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.