CacheBy
Atlas Antibodies Anti-RCOR1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-RCOR1 Antibody

상품 한눈에 보기

Human RCOR1 단백질을 인식하는 토끼 폴리클로날 항체로, REST corepressor 1 연구에 적합. Affinity purification 방식으로 높은 특이성과 재현성 제공. 인간에서 검증된 반응성을 가지며, COREST, KIAA0071, RCOR 유전자 연구에 활용 가능.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA049327-100 Anti-RCOR1 Antibody, REST corepressor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA049327-25 Anti-RCOR1 Antibody, REST corepressor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-RCOR1 Antibody

Anti-RCOR1 Antibody

Target Information

  • Target Protein: REST corepressor 1
  • Target Gene: RCOR1
  • Alternative Gene Names: COREST, KIAA0071, RCOR

Product Description

Polyclonal antibody against human RCOR1, designed for research applications related to REST corepressor 1.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
QEWEAEHGKEETNGPSNQKPVKSPDNSIKMPEEEDEAPVLDVRYASAS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000037896 (86%)
  • Rat ENSRNOG00000008067 (80%)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

ICC (Immunocytochemistry)

Datasheet

Open Datasheet (PDF)

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.