Atlas Antibodies Anti-RCN1 Antibody
상품 한눈에 보기
Human RCN1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며 사람과 생쥐에서 검증되었습니다. 고순도 IgG로 다양한 연구 응용에 신뢰성 있는 결과를 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RCN1 Antibody
Target: reticulocalbin 1, EF-hand calcium binding domain
Type: Polyclonal Antibody against Human RCN1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Independent validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human RCN1 protein.
Alternative Gene Names
FLJ37041, PIG20, Rcal, RCN
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | reticulocalbin 1, EF-hand calcium binding domain |
| Target Gene | RCN1 |
| Antigen Sequence | LGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQA |
| Verified Species Reactivity | Human, Mouse |
| Interspecies Homology | Rat ENSRNOG00000013452 (92%), Mouse ENSMUSG00000005973 (92%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Use gentle mixing before application.
- Optimal concentrations and conditions should be determined experimentally by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.