Atlas Antibodies Anti-RCN1 Antibody

상품 한눈에 보기

Human RCN1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며 사람과 생쥐에서 검증되었습니다. 고순도 IgG로 다양한 연구 응용에 신뢰성 있는 결과를 제공합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA038474-100 Anti-RCN1 Antibody, reticulocalbin 1, EF-hand calcium binding domain 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA038474-25 Anti-RCN1 Antibody, reticulocalbin 1, EF-hand calcium binding domain 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: reticulocalbin 1, EF-hand calcium binding domain
Type: Polyclonal Antibody against Human RCN1

Immunohistochemistry (IHC)
Western Blot (WB) — Independent validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Immunocytochemistry (ICC)

Polyclonal antibody raised in rabbit against human RCN1 protein.

FLJ37041, PIG20, Rcal, RCN

항목	내용
Target Protein	reticulocalbin 1, EF-hand calcium binding domain
Target Gene	RCN1
Antigen Sequence	LGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQA
Verified Species Reactivity	Human, Mouse
Interspecies Homology	Rat ENSRNOG00000013452 (92%), Mouse ENSMUSG00000005973 (92%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand