
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-RCN1 Antibody
상품 한눈에 보기
Human RCN1 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원으로 친화 정제되었으며 사람과 생쥐에서 검증되었습니다. 고순도 IgG로 다양한 연구 응용에 신뢰성 있는 결과를 제공합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA038474-100 Anti-RCN1 Antibody, reticulocalbin 1, EF-hand calcium binding domain 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA038474-25 Anti-RCN1 Antibody, reticulocalbin 1, EF-hand calcium binding domain 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RCN1 Antibody
Anti-RCN1 Antibody
Target: reticulocalbin 1, EF-hand calcium binding domain
Type: Polyclonal Antibody against Human RCN1
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB) — Independent validation: Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody raised in rabbit against human RCN1 protein.
Alternative Gene Names
FLJ37041, PIG20, Rcal, RCN
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | reticulocalbin 1, EF-hand calcium binding domain |
| Target Gene | RCN1 |
| Antigen Sequence | LGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQA |
| Verified Species Reactivity | Human, Mouse |
| Interspecies Homology | Rat ENSRNOG00000013452 (92%), Mouse ENSMUSG00000005973 (92%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Use gentle mixing before application.
- Optimal concentrations and conditions should be determined experimentally by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



