CacheBy
Thermo Fisher Scientific APLP1 Polyclonal Antibody
원본

Thermo Fisher Scientific APLP1 Polyclonal Antibody

상품 한눈에 보기

APLP1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal 항체로, WB, IHC, ICC, Flow Cytometry에 적합합니다. Human, Mouse, Rat 반응성을 가지며, 항원 친화 크로마토그래피로 정제되었습니다. 연구용으로만 사용 가능합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 05. 오후 09:27
Thermo Fisher Scientific PA578795 APLP1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific APLP1 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC-P) 0.5–1 µg/mL
Immunohistochemistry (Frozen) (IHC-F) 0.5–1 µg/mL
Immunocytochemistry (ICC/IF) 0.5–1 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

Specification Description
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human APLP1 (82–112aa: RRCLRDPQRVLEYCRQMYPELQIARVEQATQ)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS with 5 mg BSA
Contains 0.05 mg sodium azide
Storage Conditions –20°C
Shipping Conditions Ambient (domestic); Wet ice (international)
RRID AB_2745911

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

This gene encodes a member of the highly conserved amyloid precursor protein gene family. The encoded protein is a membrane-associated glycoprotein cleaved by secretases in a manner similar to amyloid beta A4 precursor protein cleavage. This cleavage liberates an intracellular cytoplasmic fragment that may act as a transcriptional activator. The encoded protein may also play a role in synaptic maturation during cortical development. Alternatively spliced transcript variants encoding different isoforms have been described.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.