CacheBy
Thermo Fisher Scientific PIK3CB Polyclonal Antibody
원본

Thermo Fisher Scientific PIK3CB Polyclonal Antibody

상품 한눈에 보기

PIK3CB 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 IHC(P) 실험에 적합합니다. Human, Mouse, Rat에 반응하며 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 시 500 µg/mL 농도로 사용 가능합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 10:28
Thermo Fisher Scientific PA579821 PIK3CB Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific PIK3CB Polyclonal Antibody

Applications

Application Tested Dilution
Western Blot (WB) 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human PIK3CB (556–598aa: DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW).
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Wet ice
RRID AB_2746936

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

PIK3CB (phosphatidylinositol 4,5-biphosphate 3-kinase catalytic subunit beta isoform)는 phosphoinositide-3-kinase로서 PtdIns, PtdIns4P, PtdIns(4,5)P2를 인산화하여 phosphatidylinositol 3,4,5-triphosphate (PIP3)를 생성합니다.
PIP3는 PH 도메인을 가진 단백질을 세포막으로 모집하여 세포 성장, 생존, 증식, 이동성 및 형태 조절에 관련된 신호 전달 경로를 활성화하는 데 중요한 역할을 합니다.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.