Thermo Fisher Scientific PIK3CB Polyclonal Antibody
PIK3CB 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot 및 IHC(P) 실험에 적합합니다. Human, Mouse, Rat에 반응하며 항원 친화 크로마토그래피로 정제되었습니다. 동결건조 형태로 제공되며 재구성 시 500 µg/mL 농도로 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.1–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human PIK3CB (556–598aa: DLIWTLRQDCREIFPQSLPKLLLSIKWNKLEDVAQLQALLQIW). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2746936 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
PIK3CB (phosphatidylinositol 4,5-biphosphate 3-kinase catalytic subunit beta isoform)는 phosphoinositide-3-kinase로서 PtdIns, PtdIns4P, PtdIns(4,5)P2를 인산화하여 phosphatidylinositol 3,4,5-triphosphate (PIP3)를 생성합니다.
PIP3는 PH 도메인을 가진 단백질을 세포막으로 모집하여 세포 성장, 생존, 증식, 이동성 및 형태 조절에 관련된 신호 전달 경로를 활성화하는 데 중요한 역할을 합니다.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific PIAS1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PIK3R2 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PIK3CB Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PI3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PGRMC1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|