CacheBy
Thermo Fisher Scientific PGRMC1 Polyclonal Antibody
원본

Thermo Fisher Scientific PGRMC1 Polyclonal Antibody

상품 한눈에 보기

PGRMC1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, WB 및 IHC(P)에서 검증됨. 항원 친화 크로마토그래피로 정제되었으며, 리오필라이즈 형태로 제공. 인체, 마우스, 랫트 반응성. 연구용으로만 사용 가능.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 28. 오전 09:24
Thermo Fisher Scientific PA579816 PGRMC1 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
568,000원VAT 포함 624,800원

Thermo Fisher Scientific · Thermo Fisher Scientific PGRMC1 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.1–0.5 µg/mL

Immunohistochemistry (Paraffin) (IHC (P))

  • Tested Dilution: 0.5–1 µg/mL

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence in the middle region of human PGRMC1 (67–102aa RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Antigen affinity chromatography
Storage buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage conditions -20°C
Shipping conditions Wet ice
RRID AB_2746931

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

The protein encoded by this gene is a transforming protein related to Rho-specific exchange factors and yeast cell cycle regulators. Its expression increases with the onset of DNA synthesis and remains elevated during G2 and M phases. In situ hybridization analysis shows high expression in mitotic cells during liver regeneration, suggesting a cell cycle-dependent role in cytokinesis regulation.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 없음)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.