Thermo Fisher Scientific PGRMC1 Polyclonal Antibody
PGRMC1 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, WB 및 IHC(P)에서 검증됨. 항원 친화 크로마토그래피로 정제되었으며, 리오필라이즈 형태로 제공. 인체, 마우스, 랫트 반응성. 연구용으로만 사용 가능.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P))
- Tested Dilution: 0.5–1 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human PGRMC1 (67–102aa RLKRRDFTPAELRRFDGVQDPRILMAINGKVFDVTK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Antigen affinity chromatography |
| Storage buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage conditions | -20°C |
| Shipping conditions | Wet ice |
| RRID | AB_2746931 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
The protein encoded by this gene is a transforming protein related to Rho-specific exchange factors and yeast cell cycle regulators. Its expression increases with the onset of DNA synthesis and remains elevated during G2 and M phases. In situ hybridization analysis shows high expression in mitotic cells during liver regeneration, suggesting a cell cycle-dependent role in cytokinesis regulation.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 없음)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific PIK3CB Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PI3 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PGRMC1 Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific REA Polyclonal Antibody
568,000원
Thermo Fisher Scientific
Thermo Fisher Scientific PGK1 Polyclonal Antibody
568,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|