Thermo Fisher Scientific SLC29A3 Polyclonal Antibody
Rabbit polyclonal antibody targeting human SLC29A3 protein. Validated for WB and ICC/IF applications. High specificity with recombinant immunogen and antigen affinity purification. Suitable for research use only.
- 카탈로그번호
- PA566109
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific SLC29A3 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.04–0.4 µg/mL
Immunocytochemistry (ICC/IF)
- Tested Dilution: 0.25–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant Human SLC29A3. Recombinant protein control fragment (Product #RP-105085) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.05 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long-term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2664676 |
Product Specific Information
- Immunogen sequence:
KEYWMFKLRNSSSPATGEDPEGSDILNYFE - Highest antigen sequence identity to orthologs: mouse 80%, rat 80%
Target Information
SLC29A3 is a member of the equilibrative nucleoside transporter family, which plays a key role in nucleoside and nucleobase uptake for salvage pathways of nucleotide synthesis.
It is a transmembrane glycoprotein localized to the lysosomal membrane and functions as a broad selectivity, low-affinity nucleoside transporter.
Mutations in the SLC29A3 gene have been associated with H syndrome, characterized by cutaneous hyperpigmentation and hypertrichosis, hepatosplenomegaly, heart anomalies, and hypogonadism.
A related disorder, PHID (pigmented hypertrichosis with insulin-dependent diabetes mellitus), is also linked to mutations at this locus.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일명: PA5-66109_SLC29A3_Q9BZD2-1_Rabbit.svg, PA5-66109_SLC29A3_Q9BZD2-1_Rabbit_PDP.jpeg)
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.