Thermo Fisher Scientific SLC29A3 Polyclonal Antibody
Rabbit polyclonal antibody targeting human SLC29A3 protein. Validated for WB and ICC/IF applications. High specificity with recombinant immunogen and antigen affinity purification. Suitable for research use only.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.04–0.4 µg/mL
Immunocytochemistry (ICC/IF)
- Tested Dilution: 0.25–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant Human SLC29A3. Recombinant protein control fragment (Product #RP-105085) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.05 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long-term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2664676 |
Product Specific Information
- Immunogen sequence:
KEYWMFKLRNSSSPATGEDPEGSDILNYFE - Highest antigen sequence identity to orthologs: mouse 80%, rat 80%
Target Information
SLC29A3 is a member of the equilibrative nucleoside transporter family, which plays a key role in nucleoside and nucleobase uptake for salvage pathways of nucleotide synthesis.
It is a transmembrane glycoprotein localized to the lysosomal membrane and functions as a broad selectivity, low-affinity nucleoside transporter.
Mutations in the SLC29A3 gene have been associated with H syndrome, characterized by cutaneous hyperpigmentation and hypertrichosis, hepatosplenomegaly, heart anomalies, and hypogonadism.
A related disorder, PHID (pigmented hypertrichosis with insulin-dependent diabetes mellitus), is also linked to mutations at this locus.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
제품 이미지
(이미지 파일명: PA5-66109_SLC29A3_Q9BZD2-1_Rabbit.svg, PA5-66109_SLC29A3_Q9BZD2-1_Rabbit_PDP.jpeg)
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific SLC10A7 Polyclonal Antibody
791,800원
Thermo Fisher Scientific
Thermo Fisher Scientific ARHGAP21 Polyclonal Antibody
791,800원
Thermo Fisher Scientific
Thermo Fisher Scientific SLC29A3 Polyclonal Antibody
791,800원
Thermo Fisher Scientific
Thermo Fisher Scientific Carbonic Anhydrase X Polyclonal Antibody
791,800원
Thermo Fisher Scientific
Thermo Fisher Scientific NEMP2 Polyclonal Antibody
791,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|