CacheBy
Thermo Fisher Scientific SLC29A3 Polyclonal Antibody
원본

Thermo Fisher Scientific SLC29A3 Polyclonal Antibody

상품 한눈에 보기

Rabbit polyclonal antibody targeting human SLC29A3 protein. Validated for WB and ICC/IF applications. High specificity with recombinant immunogen and antigen affinity purification. Suitable for research use only.

카탈로그번호
PA566109
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 07. 29. 오전 08:57
Thermo Fisher Scientific PA566109 SLC29A3 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
791,800원VAT 포함 870,980원

Thermo Fisher Scientific · Thermo Fisher Scientific SLC29A3 Polyclonal Antibody

Applications

Western Blot (WB)

  • Tested Dilution: 0.04–0.4 µg/mL

Immunocytochemistry (ICC/IF)

  • Tested Dilution: 0.25–2 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Recombinant Human SLC29A3. Recombinant protein control fragment (Product #RP-105085)
Conjugate Unconjugated
Form Liquid
Concentration 0.05 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS, pH 7.2, with 40% glycerol
Contains 0.02% sodium azide
Storage Conditions Store at 4°C short term. For long-term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping Conditions Wet ice
RRID AB_2664676

Product Specific Information

  • Immunogen sequence: KEYWMFKLRNSSSPATGEDPEGSDILNYFE
  • Highest antigen sequence identity to orthologs: mouse 80%, rat 80%

Target Information

SLC29A3 is a member of the equilibrative nucleoside transporter family, which plays a key role in nucleoside and nucleobase uptake for salvage pathways of nucleotide synthesis.
It is a transmembrane glycoprotein localized to the lysosomal membrane and functions as a broad selectivity, low-affinity nucleoside transporter.
Mutations in the SLC29A3 gene have been associated with H syndrome, characterized by cutaneous hyperpigmentation and hypertrichosis, hepatosplenomegaly, heart anomalies, and hypogonadism.
A related disorder, PHID (pigmented hypertrichosis with insulin-dependent diabetes mellitus), is also linked to mutations at this locus.


For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.

제품 이미지

(이미지 파일명: PA5-66109_SLC29A3_Q9BZD2-1_Rabbit.svg, PA5-66109_SLC29A3_Q9BZD2-1_Rabbit_PDP.jpeg)

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.