CacheBy
Thermo Fisher Scientific SCN11A Polyclonal Antibody
원본

Thermo Fisher Scientific SCN11A Polyclonal Antibody

상품 한눈에 보기

SCN11A 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot, IHC, Flow cytometry에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 고순도의 affinity chromatography 정제 제품입니다. 연구용으로만 사용 가능합니다.

카탈로그번호
PA5114378
판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오전 03:32
Thermo Fisher Scientific PA5114378 SCN11A Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
680,400원VAT 포함 748,440원

Thermo Fisher Scientific · Thermo Fisher Scientific SCN11A Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.25–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human SCN11A (MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping Conditions Wet ice
RRID AB_2884834

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Epithelial sodium channels (ENaC) are amiloride-sensitive members of the Degenerin/epithelial sodium channel (Deg/ENaC) superfamily of ion channels. These channels share structural features including two short intracellular amino and carboxyl termini, two short membrane-spanning segments, and a large extracellular loop with a conserved cysteine-rich region.

There are three homologous isoforms of ENaC (alpha, beta, and gamma). ENaC in the kidney, lung, and colon plays an essential role in trans-epithelial sodium and fluid balance. It mediates aldosterone-dependent sodium reabsorption in the distal nephron of the kidney, thus regulating blood pressure. ENaC is thought to be regulated, in part, through association with the cystic fibrosis transmembrane conductance regulator (CFTR) chloride ion channel.

Gain-of-function mutations in beta- or gamma-ENaC can cause severe arterial hypertension (Liddle’s syndrome), while loss-of-function mutations in alpha- or beta-ENaC cause pseudohypoaldosteronism (PHA-1).


For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.