Thermo Fisher Scientific SCN11A Polyclonal Antibody

Thermo Fisher Scientific SCN11A Polyclonal Antibody

상품 한눈에 보기

SCN11A 단백질을 인식하는 Rabbit Polyclonal 항체로, Western blot, IHC, Flow cytometry에 적합합니다. Human, Mouse, Rat 시료에 반응하며, 고순도의 affinity chromatography 정제 제품입니다. 연구용으로만 사용 가능합니다.

상품 옵션 정보

다양한 옵션의 상품 정보와 가격을 확인하세요

마지막 업데이트
2025. 08. 04. 오전 03:32
소모품
PA5114378
Thermo Fisher Scientific PA5114378 SCN11A Polyclonal Antibody 100 ug pk
CAS: -단위: pk
재고문의재고: -
680,400
(VAT포함)748,440
소모품
PA5114378
재고문의재고: -
Thermo Fisher Scientific PA5114378 SCN11A Polyclonal Antibody 100 ug pk
CAS: -단위: pk
680,400
(VAT포함)748,440

AI 추천 연관 상품

AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요

연관 상품을 찾고 있습니다...

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.25–0.5 µg/mL
Immunohistochemistry (Paraffin) (IHC (P)) 0.5–1 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human SCN11A (MDDRCYPVIFPDERNFRPFTSDSLAAIEKRIAIQKEKKK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping Conditions Wet ice
RRID AB_2884834

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Epithelial sodium channels (ENaC) are amiloride-sensitive members of the Degenerin/epithelial sodium channel (Deg/ENaC) superfamily of ion channels. These channels share structural features including two short intracellular amino and carboxyl termini, two short membrane-spanning segments, and a large extracellular loop with a conserved cysteine-rich region.

There are three homologous isoforms of ENaC (alpha, beta, and gamma). ENaC in the kidney, lung, and colon plays an essential role in trans-epithelial sodium and fluid balance. It mediates aldosterone-dependent sodium reabsorption in the distal nephron of the kidney, thus regulating blood pressure. ENaC is thought to be regulated, in part, through association with the cystic fibrosis transmembrane conductance regulator (CFTR) chloride ion channel.

Gain-of-function mutations in beta- or gamma-ENaC can cause severe arterial hypertension (Liddle’s syndrome), while loss-of-function mutations in alpha- or beta-ENaC cause pseudohypoaldosteronism (PHA-1).


For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.


배송/결제/교환/반품 안내

배송 정보

기본 배송비
  • - 배송비 3,850원 (부가세 포함)
  • - 10만원 이상 구매시 배송비 무료
  • - 도서산간 및 제주를 포함한 일부 지역 추가비용 발생
  • - 장비의 경우 추가 배송비 및 설치비가 청구 될 수 있습니다
교환/반품 배송비
  • - 상품 별로 상이
착불 배송비
  • - 착불 적용 상품에 개별 부과 (상품 별로 상이)
교환/반품 배송비
  • - 상품 별로 상이

결제 및 환불 안내

결제수단
  • - 신용카드
  • - 가상계좌
  • - 연구비카드
  • - 세금계산서 (기업은행 033-502993-01-019)
  • - 세금계산서 (신한은행 100-032-703829)
  • - 상품 결제 후 최대 60일 이내 제공 완료
취소
  • - 취소 접수 후 3 ~ 5일 이내 환불 처리
반품
  • - 반품 접수 후 3 ~ 5일 이내 환불 처리
환급
  • - 회사는 회원이 구매신청한 상품 등이 품절 등의 사유로 인도 또는 제공할 수 없을 때에는 지체 없이 그 사유를 회원에게 통지하고,
      사전에 상품 등의 대금을 받은 경우에는 대금을 받은 날로부터 3영업일 이내에 환급하거나 환급에 필요한 조치를 취합니다.

교환 및 반품 접수

교환 및 반품 접수 기한
  • - 상품 수령일로부터 7일 이내
교환 및 반품 접수가 가능한 경우
  • - 제품의 하자는 없지만, 다른 상품으로 교환하거나 반품 원하는 경우
     (배송비 고객 부담)
  • - 상품자체 불량 및 하자에 의한 경우
  • - 상품 오배송에 의한 경우
교환 및 반품 접수가 불가능한 경우
  • - 상품 수령 후 7일을 초과한 경우
  • - 개별 포장 상품의 포장을 훼손한 경우
  • - 고객의 고의적인 귀책으로 상품가치가 훼손된 경우
  • - 주문제작을 통해서 제품을 생산하는 경우
  • - 주문 당시 재고가 없어서 해외를 통해 제품을 수입해서 구매하는 경우

교환 및 반품 신청

교환 절차
  • - 상품 불량/오배송/상품파손
  • - 전화(02-585-1342) 또는 info@cacheby.com에 상품교환 접수
반품 절차
  • - 반품할 품목을 확인 후 info@cacheby.com로 반품 신청 (수령 후 7일 이내 가능하며 이후 불가)
  • - 전달드린 주문번호와 함께 반품 상품을 포장
     (포장을 꼼꼼하게 해주셔야 반품 상품 손상에 따른 불이익이 없습니다.)
  • - 택배회사 방문 시 반품 상품 전달
     (택배사의 반송장은 상품 교환이 완료될 때까지 보관해주시기 바랍니다.)
  • - 회수된 제품 확인 후 하자없을시 배송비를 제외하고 환불 처리 진행
     (환불 처리 후 입금까지 최대 2주까지 소요될 수 있습니다.)

문의 0