원본
Atlas Antibodies Anti-RARG Antibody
상품 한눈에 보기
Human RARG 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. NR1B3, RARC 유전자 대체명으로도 알려져 있으며, Affinity purification 방식으로 정제되었습니다. Human에 대해 검증된 반응성을 보입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA053883-100 Anti-RARG Antibody, retinoic acid receptor, gamma 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA053883-25 Anti-RARG Antibody, retinoic acid receptor, gamma 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-RARG Antibody
Anti-RARG Antibody
Target: Retinoic acid receptor, gamma (RARG)
Type: Polyclonal Antibody against Human RARG
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot)
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody raised in rabbit against human RARG, also known as retinoic acid receptor gamma.
Alternative Gene Names
- NR1B3
- RARC
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Retinoic acid receptor, gamma |
| Target Gene | RARG |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMASLSVET |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | 유전자 ID | 항원 서열 동일성 |
|---|---|---|
| Mouse | ENSMUSG00000001288 | 98% |
| Rat | ENSRNOG00000012499 | 97% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Information
| 구성 성분 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.