Atlas Antibodies Anti-RARS2 Antibody

상품 한눈에 보기

Human RARS2 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 제조됨. IHC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공. Human 반응성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA039987-100 Anti-RARS2 Antibody, arginyl-tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA039987-25 Anti-RARS2 Antibody, arginyl-tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: arginyl-tRNA synthetase 2, mitochondrial
Supplier: Atlas Antibodies

IHC (Immunohistochemistry)

Polyclonal antibody against Human RARS2.

DALRD2, dJ382I10.6, MGC14993, MGC23778, PRO1992, RARSL

항목	내용
Target Protein	arginyl-tRNA synthetase 2, mitochondrial
Target Gene	RARS2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse (76%), Rat (75%)

Antigen Sequence:
LSVDSLLEKDNDHSRPDIQVQAKRLAEKLRCDTVVSEISTGQRTVNFKINRELLTKTVLQQVIEDGSKYGLKSELFSGLP

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Safety	Material Safety Data Sheet