
Atlas Antibodies Anti-RAI14 Antibody
Human RAI14 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB 분석에 적합합니다. Orthogonal validation으로 검증되었으며, Human과 Mouse에 반응합니다. 고순도 Affinity 정제 방식으로 제조되었습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-RAI14 Antibody
Target: retinoic acid induced 14 (RAI14)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human RAI14
Alternative Gene Names
DKFZp564G013, KIAA1334, NORPEG, RAI13
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | retinoic acid induced 14 |
| Target Gene | RAI14 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | ISPTQLSDVSSPRSITSTPLSGKESVFFAEPPFKAEISSIRENKDRLSDSTTGADSLLDISSEADQQDLLSLLQAKVASLTLHNKELQDK |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Mouse | Verified |
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000022246 (96%)
- Rat ENSRNOG00000028872 (94%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-RAI2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RALGAPA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RAI14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RAI14 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-RAD9A Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|